PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G415077_P01
Common NameMYBR45, Zm.1353
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB_related
Protein Properties Length: 171aa    MW: 18706.5 Da    PI: 10.3583
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G415077_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.51.3e-122771147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       r +WT++E+ ++++a  ++G + Wk++ + +  ++t+ q++s+ qk+
  GRMZM2G415077_P01 27 REKWTADEHGRFLHALLLFGRD-WKRVQAFVA-TKTGTQIRSHAQKH 71
                       789*****************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.8142276IPR017930Myb domain
SuperFamilySSF466894.41E-142276IPR009057Homeodomain-like
SMARTSM007171.8E-72674IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.7E-142674IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.6E-72771IPR009057Homeodomain-like
PfamPF002492.3E-102771IPR001005SANT/Myb domain
CDDcd001671.08E-62972No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009074anatomystyle
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020127anatomyprimary root
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001180developmental stageplant proembryo stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MAAAAVKSSA GMAGKKSRKP YVVSRPREKW TADEHGRFLH ALLLFGRDWK RVQAFVATKT  60
GTQIRSHAQK HFLRADKKLG LAVPPRHPHR SAAGCPAWCA DDGGTLAPDV ETVQFPLSPD  120
DLRLAQVYRF VGDVLGSSVE AQLHRLLGAD PVVVDTVLRV LANLQDNLDI L
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.13530.0meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G415077
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G415077_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9761860.0EU976186.1 Zea mays clone 679787 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001145539.11e-122putative MYB DNA-binding domain superfamily protein
RefseqXP_008672271.11e-122PREDICTED: putative MYB DNA-binding domain superfamily protein isoform X1
TrEMBLB6UG211e-122B6UG21_MAIZE; MYB-related transcription factor
STRINGGRMZM2G415077_P011e-122(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Representative plantOGRP12551549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.22e-25MYB_related family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]